What is the Additional Feature ?

Any Feature, including a modified Existing Feature, that is not an Existing Feature.

Cart ( )

lmages are for reference only See Product Specifications

Renesas Electronics America Inc 1337DCGI

Part No.:: 1337DCGI

Manufacturer:: Renesas Electronics America Inc

Package:: 8-SOIC (0.154, 3.90mm Width)

Datasheet:: 1337DCGI.pdf

Description:: IC RTC CLK/CALENDAR I2C 8-SOIC

In Stock:: 2098

Quantity:: Add To Cart

For more detailed including pricing and shipping

: Quick response, quick quotation

: Flash shipment, no worries after sales

: Original channel, guarantee of the authentic products

Please send RFQ , we will respond immediately.

Purchase and inquiry

1337DCGI Specifications

Package/Case:
8-SOIC (0.154, 3.90mm Width)
Packaging:
Tube
Series:
-
ProductStatus:
Obsolete
Type:
Clock/Calendar
Features:
Alarm, Leap Year, Square Wave Output
MemorySize:
-
TimeFormat:
HH:MM:SS (12/24 hr)
DateFormat:
YY-MM-DD-dd
Interface:
I²C, 2-Wire Serial
Voltage-Supply:
1.8V ~ 5.5V
Voltage-SupplyBattery:
-
Current-Timekeeping(Max):
0.6µA @ 1.3V ~ 1.8V
OperatingTemperature:
-40°C ~ 85°C
MountingType:
Surface Mount

1337DCGI this integrated circuit is available in factory sealed anti static packs. at icwhale.com. Please read product page below detail information. including 1337DCGI price, data-sheet, in-stock availability, technical difficulties. Also. Quickly Enter the access of compare listing to find out replaceable electronic parts. If you want to retrieve comprehensive data for 1337DCGI to optimize the supply chain (including cross references, life-cycle, parametric, counterfeit risk, obsolescence managements forecasts), please contact to our Tech-supports team.

Purchase in icwhale.com

There is no doubt that you may place an order without registering to icwhale.com.

We strongly suggest you sign in our shop before purchasing as you can track your order real-time tracking.

Means of Payment in icwhale.com

For your convenience, we support multiple payment methods in USD, including PayPal, Credit Card, wire transfer. and Alipay.

RFQ (Request for Quotations) in icwhale.com

It is recommended to acquire for quotations to get the latest prices and inventories about the parts.

Our sales will reply to your request by email within 24 hours.

Warm reminder

1. You'll receive an order information email in your email inbox. (Please remember to check the spam folder if you didn't hear from us).

2. Since inventories and prices may fluctuate to some extent, the sales manager is going to reconfirm the order and let you know if there are any updates.

Shipping & Handling

Shipping fee starts at $35, but some countries will exceed $35. For example (South Africa, Brazil, India, Pakistan, Israel, etc.)

The basic freight (for package ≤0.5kg or corresponding volume) depends on the time zone and countries.

Shipping Method

Currently, our products are shipped through DHL, FedEx, SF, UPS and China Post.

Order Tracking for International Orders

Once your order has been shipped, the tracking number will be sent to the email address registered to your account. This information can also be viewed when logged into your account in the "my account" page.

1337DCGI information

Views：

Basic introduction and simple engineering application of 1337DCGI

1337DCGI is a powerful tool used in bioinformatics and computational biology for analyzing DNA and protein sequences. It stands for "Leet Domain Contact Graph Index," which represents a graph-based indexing technique specifically designed to efficiently store and query information about domain contacts in protein structures.

Application in Bioinformatics:

In bioinformatics research, 1337DCGI plays a crucial role in understanding protein structure and function. It can be applied in various areas such as protein folding prediction, structural alignment, and drug discovery.

Experiment:

To demonstrate the basic functionality of 1337DCGI, let's perform a simple experiment using a sample protein sequence.

1. Protein Sequence Retrieval:

Obtain a protein sequence from a public database or use a sample sequence for demonstration purposes. For example, let's consider the following protein sequence:

 MKALIVLGLALVTGVASFADYNKTKEDLVVVYGPNFVTEVQDNLKVKNVGKGKLATYTIEY

2. Domain Identification:

Use bioinformatics tools or databases to identify domains within the protein sequence. For this experiment, let's assume the following domains are identified:

 Domain 1: MKALIVLGLALVTGVA
	Domain 2: VASFADYNKTKEDLVVVYGPNFVTEVQDNLKVK
	Domain 3: NVGKGKLATYTIEY

3. Constructing the Contact Graph:

For each identified domain, construct a contact graph representing the interactions between amino acids. Each node in the graph represents an amino acid, and edges represent contacts between amino acids within a certain distance threshold.

4. Indexing with 1337DCGI:

Use 1337DCGI to index the constructed contact graphs efficiently. This indexing allows for fast retrieval and query of domain contact information, enabling rapid analysis of protein structure.

5. Querying Domain Contacts:

Perform queries using 1337DCGI to retrieve information about domain contacts within the protein structure. This information can provide insights into the spatial arrangement of protein domains and potential functional implications.

Conclusion:

In this experiment, we've demonstrated the basic steps of using 1337DCGI for analyzing protein structure. By efficiently indexing domain contacts, 1337DCGI enables researchers to gain valuable insights into protein function and interactions, driving advancements in bioinformatics and computational biology.

1337DCGI FAQ

1. How to order 1337DCGI on icwhale.com?

Currently, icwhale.com only provide peer-to-peer order processing. While you submit the RFQ, our professional agent will contact you with the competitive prices in the global market, and our agent will prompt you to finish the order if you accept our offers.

2. How does icwhale.com guarantee that 1337DCGI is from the original manufacturer or authorized agents?

We have a professional and experienced quality control team to strictly verify and test the 1337DCGI. All suppliers must pass our qualification reviews before they can publish their products including 1337DCGI on icwhale.com; we pay more attention to the channels and quality of 1337DCGI products than any other customer. We strictly implement supplier audits, so you can purchase with confidence.

3. Are the 1337DCGI price and inventory displayed accurate?

The price and inventory of 1337DCGI fluctuates frequently and cannot be updated in time, it will be updated periodically within 24 hours. And, our quotation usually expires after 5 days.

4. What forms of payment are accepted?

Wire Transfer, PayPal, Alipay, Wechat, Credit Card, Western Union, MoneyGram, and Escrow are all acceptable.

Warm Tips: Some orders in certain payment forms may require handling fee.

5. How is the shipping arranged?

Customers can choose industry-leading freight companies, including DHL, UPS, FedEx, TNT, and Registered Mail. Shipping insurance is also available.

Once your order has been processed for shipment, our salesperson will send you an email advising you of the shipping status and tracking number.

Warm Tips: It may take up to 24 hours for the carriers to display tracking information. Usually, express delivery takes 3-5 days, and registered mail takes 25-60 days.

6. What is the process for return or replacement of 1337DCGI?

All goods will implement Pre-Shipment Inspection (PSI), selected at random from all batches of your order to do a systematic inspection before arranging the shipment. If there is something wrong with the 1337DCGI we delivered, we will accept the replacement or return of the 1337DCGI only when all of the below conditions are fulfilled:

(1)Such as a deficiency in quantity, delivery of wrong items, and apparent external defects (breakage and rust, etc.), and we acknowledge such problems.

(2)We are informed of the defect described above within 90 days after the delivery of 1337DCGI.

(3)The PartNo is unused and only in the original unpacked packaging.

Two processes to return the products:

(1)Inform us within 90 days

(2)Obtain Requesting Return Authorizations